Host taxon 10090
Protein NP_063923.1
N-alpha-acetyltransferase 10 isoform 1
Mus musculus
Gene Naa10, UniProt Q9QY36
>NP_063923.1|Yersinia pseudotuberculosis IP 32953|N-alpha-acetyltransferase 10 isoform 1
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.7 | -0.704894661012781 | 0.024 | 28096329 | |
Retrieved 1 of 4 entries in 0.9 ms
(Link to these results)