Host taxon 10090
Protein NP_780297.3
myoD family inhibitor domain-containing protein
Mus musculus
Gene Mdfic, UniProt Q8BX65
>NP_780297.3|Yersinia pseudotuberculosis IP 32953|myoD family inhibitor domain-containing protein
MSCAGEALAPGPAEQQCPVEAGGGRLGSPAHEACNEDNTEKDKRPATSGHTRCGLMRDQSIWPNPSAGELVRTQPERLPQLQTSAQEPGKEETGKIKNGGHTRMSNGNGIPHGAKHVSVENHKISAPVSQKMHRKIQSSLSVNNDISKKSKVNAVFSPKAASSPEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCSCPCDMDCGIMDACCESSDCLEICMECCGICFPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.85 | 0.852165667991462 | 0.00029 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)