Bacterial taxon 273123
Protein WP_002209221.1
multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
Yersinia pseudotuberculosis IP 32953
Gene nadR, UniProt Q66EV3
>WP_002209221.1|Yersinia pseudotuberculosis IP 32953|multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
MLQFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNDKIKSPSAQKLEALHRFLGLEFPRREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPRDRELFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHSFDEHGIEPYPHGWDVWSRGVKAFMNEKGIVPSFIYSSESQDAPRYREQLGIETILIDPQRSFMNISGRQIRRDPFRYWDYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGREYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSDRDRKSFQNLLEQMLRDNNIEYVHVESADYDARFLRCVELVQQLLAADPQRLARPSVLTDAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.41 | 2.41410801379907 | 8.2e-7 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.56 | 1.55973033065528 | 0.00047 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ 1.3 | 1.30494530816867 | 0.00021 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.81 | 0.81338626995749 | 0.011 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)