Host taxon 10090
Protein NP_001171416.1
mth938 domain-containing protein isoform 1
Mus musculus
Gene Aamdc, UniProt Q8R0P4
>NP_001171416.1|Yersinia pseudotuberculosis IP 32953|mth938 domain-containing protein isoform 1
MYVRFPELLPTLLLTSQVLGSQISAQLLMASPKIASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVKEVAEKGVQTLVIGRGMSEALKVPPSTVEYLEKQGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.01 | -2.00534899380011 | 6.8e-6 | 28096329 | |
Retrieved 1 of 3 entries in 1.2 ms
(Link to these results)