Host taxon 10090
Protein NP_083630.1
mitotic-spindle organizing protein 2
Mus musculus
Gene Mzt2, UniProt Q9CQ25
>NP_083630.1|Yersinia pseudotuberculosis IP 32953|mitotic-spindle organizing protein 2
MAAAAAAAGGAALAVSTGLETATLQKLALRRKKVLGAEEMELYELAQAAGAAIDPDVFKILVDLLNLNVAPLAVFQMLKSMCAGQRLASDPQDSVPISLSTSTSETRGRNRGGPILGNVTISAERGSRERPIQRMPRQPSATRLPKVGGSGKSNSRSSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.95 | -0.953931141086305 | 0.03 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)