Host taxon 10090
Protein NP_062372.2
mitotic spindle assembly checkpoint protein MAD2A
Mus musculus
Gene Mad2l1, UniProt Q9Z1B5
>NP_062372.2|Yersinia pseudotuberculosis IP 32953|mitotic spindle assembly checkpoint protein MAD2A
MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPELIKYLNNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEEVRLRSFTTTIHKVNSMVAYKTPVND
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.66 | 0.664110944042003 | 0.017 | 28096329 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)