Host taxon 10090
Protein NP_001240641.1
mitochondrial peptide methionine sulfoxide reductase isoform 1
Mus musculus
Gene Msra, UniProt Q9D6Y7
>NP_001240641.1|Yersinia pseudotuberculosis IP 32953|mitochondrial peptide methionine sulfoxide reductase isoform 1
MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVTAKHHVSGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGHTRNPTYKEVCSEKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQGMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQKVLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPMAIKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.43 | -1.42512080585438 | 1.8e-10 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)