Host taxon 10090
Protein NP_766197.2
mitochondrial import receptor subunit TOM22 homolog
Mus musculus
Gene Tomm22, UniProt Q9CPQ3
>NP_766197.2|Yersinia pseudotuberculosis IP 32953|mitochondrial import receptor subunit TOM22 homolog
MAAAVAAAGAGEPLSPEELLPKAEAEKAEEELEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.67 | 0.667763182708159 | 0.032 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)