Host taxon 10090
Protein NP_001156715.1
mitochondrial fission 1 protein isoform 2
Mus musculus
Gene Fis1, UniProt Q9CQ92
>NP_001156715.1|Yersinia pseudotuberculosis IP 32953|mitochondrial fission 1 protein isoform 2
MPRDEAARNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.79 | -0.794121733675367 | 0.00014 | 28096329 | |
Retrieved 1 of 3 entries in 2 ms
(Link to these results)