Host taxon 10090
Protein NP_038798.2
mitochondrial dicarboxylate carrier
Mus musculus
Gene Slc25a10, UniProt Q9QZD8
>NP_038798.2|Yersinia pseudotuberculosis IP 32953|mitochondrial dicarboxylate carrier
MAEARASRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQVVRTDGFLALYNGLSASLCRQMTYSLTRFAIYETMRDYMTKDSQGPLPFYNKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPPSQRRNYSHALDGLYRVAREESLRKLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVSSFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAMETAKLGPQAFFKGLFPAGIRLIPHTVLTFMFLEQLRKHFGIKVPTT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.01 | -1.01057387861267 | 8.6e-5 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)