Host taxon 10090
Protein NP_001230513.1
MIF4G domain-containing protein isoform 1
Mus musculus
Gene Mif4gd, UniProt Q3UBZ5
>NP_001230513.1|Yersinia pseudotuberculosis IP 32953|MIF4G domain-containing protein isoform 1
MSEASRDDYKIQSFDAETQQLLKTALKDPGAVDLERVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQKEYDAREQLRACSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFQLAQPESLSREEEVDCLVLQLHRVGEQLEKMNGQRMDELFILIRDGFLLPTDLSSLARLLLLEMIEFRAAGWKTTPAAHKYYYSEVSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.79 | -0.787729412543782 | 0.0019 | 28096329 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)