Host taxon 10090
Protein NP_031922.1
microtubule-associated protein RP/EB family member 1
Mus musculus
Gene Mapre1, UniProt Q61166
>NP_031922.1|Yersinia pseudotuberculosis IP 32953|microtubule-associated protein RP/EB family member 1
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRPIATQRTTAAPKAGPGMVRKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.79 | 0.788457111430548 | 5.5e-5 | 28096329 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)