Host taxon 10090
Protein NP_778160.2
microsomal glutathione S-transferase 2 isoform 1
Mus musculus
Gene Mgst2, UniProt A2RST1
>NP_778160.2|Yersinia pseudotuberculosis IP 32953|microsomal glutathione S-transferase 2 isoform 1
MAGDSSLLAAVSLLSACQQSYFAWRVGRARLKHKIAPPAVTGPLEFERIFRAQQNSLEFYPVFIVMLWMAGWYFNQVFAACLGLLYIYARHKYFWGYAEAAEKRITGFRLSLGILTLLPVLAVLGVASRFLNEYLDFHVAKKLRKPF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -1 | -0.997797266424523 | 0.0057 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)