Host taxon 10090
Protein NP_082129.2
methyltransferase-like protein 7B precursor
Mus musculus
Gene Mettl7b, UniProt Q9DD20
>NP_082129.2|Yersinia pseudotuberculosis IP 32953|methyltransferase-like protein 7B precursor
MDALVLFLQLLVLLLTLPLHLLALLGCWQPICKTYFPYFMAMLTARSYKKMESKKRELFSQIKDLKGTSGNVALLELGCGTGANFQFYPQGCKVTCVDPNPNFEKFLTKSMAENRHLQYERFIVAYGENMKQLADSSMDVVVCTLVLCSVQSPRKVLQEVQRVLRPGGLLFFWEHVAEPQGSRAFLWQRVLEPTWKHIGDGCHLTRETWKDIERAQFSEVQLEWQPPPFRWLPVGPHIMGKAVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.72 | -2.72255092419852 | 2.8e-21 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)