Host taxon 10090
Protein NP_080962.1
methyltransferase-like 26
Mus musculus
Gene Mettl26, UniProt Q9DCS2
>NP_080962.1|Yersinia pseudotuberculosis IP 32953|methyltransferase-like 26
MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVDQRCLDSIAATTRAQGLSNVKAPLYLDVTWEWEQWGGIPPRSLDLLLCINMIHISPLNCTEGLFRAAGHLLKTKAVLITYGPYAVNGKISPQSNVDFDLTLRCRNPEWGLRDTVLLEELGQASGLVLERMVDMPANNKCLIFRKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.23 | -1.22695007328185 | 0.00025 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)