Host taxon 10090
Protein NP_001333597.1
methionine-R-sulfoxide reductase B1
Mus musculus
Gene Msrb1, UniProt Q9JLC3
>NP_001333597.1|Yersinia pseudotuberculosis IP 32953|methionine-R-sulfoxide reductase B1
MSFCSFFGGEVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSPWPAFTETIHPDSVTKCPEKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRFUIFSSSLKFVPKGKEAAASQGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.55 | 1.55282329018008 | 2.2e-20 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)