Host taxon 10090
Protein NP_081111.1
membrane-spanning 4-domains subfamily A member 6D
Mus musculus
Gene Ms4a6d, UniProt Q99N07
>NP_081111.1|Yersinia pseudotuberculosis IP 32953|membrane-spanning 4-domains subfamily A member 6D
MIPQVVTSETVTVISPNGISFPQTDKPQPSHQSQDSLKKHLKAEIKVMAAIQIMCAVMVLALGIILASVPSNLHFTSVFSILLESGYPFVGALFFAISGILSIVTEKKMTKPLVHSSLALSILSVLSALTGIAILSVSLAALEPALQQCKLAFTQLDTTQDAYHFFSPEPLNSCFVAKAALTGVFSLMLISSVLELGLAVLTATLWWKQSSSAFSGNVIFLSQNSKNKSSVSSESLCNPTYENILTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.79 | 1.78646322811688 | 3.7e-7 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)