Host taxon 10090
Protein NP_001159848.1
membrane-spanning 4-domains subfamily A member 6C isoform 2
Mus musculus
Gene Ms4a6c, UniProt Q99N08
>NP_001159848.1|Yersinia pseudotuberculosis IP 32953|membrane-spanning 4-domains subfamily A member 6C isoform 2
MIPQVVTNETITTISPNGINFPQKDESQPTQQRQDSLKKHLKAEIKVIVAIQIMCAVTVLALGIILASVPPVPYFNSVFSVLLKSGYPFIGALFVSRLLGGIKWGKTEKGVFTQLHFCIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.78 | 0.780759739200693 | 0.00018 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)