Host taxon 10090
Protein NP_058063.2
membrane-associated progesterone receptor component 1
Mus musculus
Gene Pgrmc1, UniProt O55022
>NP_058063.2|Yersinia pseudotuberculosis IP 32953|membrane-associated progesterone receptor component 1
MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.72 | -0.724886428298589 | 5.9e-6 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)