Host taxon 10090
Protein NP_001277419.1
mediator of RNA polymerase II transcription subunit 27 isoform d
Mus musculus
Gene Med27, UniProt Q9DB40
>NP_001277419.1|Yersinia pseudotuberculosis IP 32953|mediator of RNA polymerase II transcription subunit 27 isoform d
MLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLILINSSAQSITGPWFWS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.78 | -0.78151458218772 | 0.0032 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)