Host taxon 10090
Protein NP_613062.1
mediator of RNA polymerase II transcription subunit 10 isoform 1
Mus musculus
Gene Med10, UniProt Q9CXU0
>NP_613062.1|Yersinia pseudotuberculosis IP 32953|mediator of RNA polymerase II transcription subunit 10 isoform 1
MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.8 | 0.800863715752027 | 0.011 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)