Host taxon 10090
Protein NP_032597.1
mast cell protease 2 precursor
Mus musculus
Gene Mcpt2, UniProt P15119
>NP_032597.1|Yersinia pseudotuberculosis IP 32953|mast cell protease 2 precursor
MQALLFLMALLLPSGAGAEEIIGGVEAKPHSRPYMAYLKFTTKNGSKERCGGFLIAPQFVMTAAHCNGSEISVILGAHNINKNEPTQQIIKTEKTFVHPKFQYLSGFYDIMLLKLQKKAELNSDVDVISLPSSSDFIKPGKMCWTAGWGKTGKNNPLSVTLREVELRIMDQEACKDHSDYDYQLQVCAGSPTTSKSIGQGDSGGPLVCDSVAHGIASSYEAKAPAVFTRISYYLPWIYKVLKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.11 | -2.1064849478035 | 3.2e-10 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)