Host taxon 10090
Protein NP_081498.2
marginal zone B- and B1-cell-specific protein precursor
Mus musculus
Gene Mzb1, UniProt Q9D8I1
>NP_081498.2|Yersinia pseudotuberculosis IP 32953|marginal zone B- and B1-cell-specific protein precursor
MRLPLPLLLLFGCRAILGSAGDRVSLSASAPTLDDEEKYSAHMPAHLRCDACRAVAFQMGQRLAKAEAKSHTPDASGLQELSESTYTDVLDQTCSQNWQSYGVHEVNQMKRLTGPGLSKGPEPRISVMISGGPWPNRLSKTCFHYLGEFGEDQIYEAYRQGQANLEALLCGGTHGPCSQEILAQREEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.51 | -1.51017460238273 | 1.1e-8 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)