Host taxon 10090
Protein NP_034906.1
mannose-binding protein C precursor
Mus musculus
Gene Mbl2, UniProt P41317
>NP_034906.1|Yersinia pseudotuberculosis IP 32953|mannose-binding protein C precursor
MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.97 | -2.9699626519835 | 0.0034 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)