Host taxon 10090
Protein NP_663507.1
MAL-like protein
Mus musculus
Gene Mall, UniProt Q91X49
>NP_663507.1|Yersinia pseudotuberculosis IP 32953|MAL-like protein
MASRDTPPATSYAPPDVPSGVAALFLTIPFAFFLPELVFGFWVWTLVAATHVAYPLLQGWVLYVSLTSFLISLMFLMSYLFGFYKRFESWRVLDSLYHGTTGILYMSASVLQAYATIISEGHNLSHYYINVAASFFAFLTTLLYILHAFSIYYH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.81 | -0.81209885301811 | 4.6e-6 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)