Host taxon 10090
Protein NP_038618.1
lysozyme C-1 precursor
Mus musculus
Gene Lyz1, UniProt P17897
>NP_038618.1|Yersinia pseudotuberculosis IP 32953|lysozyme C-1 precursor
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.42 | -2.42344712772631 | 1.2e-47 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)