Host taxon 10090
Protein XP_006511494.1
lysM and putative peptidoglycan-binding domain-containing protein 2 isoform X1
Mus musculus
Gene Lysmd2, UniProt Q9D7V2
>XP_006511494.1|Yersinia pseudotuberculosis IP 32953|lysM and putative peptidoglycan-binding domain-containing protein 2 isoform X1
MEQIKRANKLFTNDCIFLKKTLSIPILSEKPLLFNGLNSIDSPESETVDSSFCQEEEPVVSEEELPPPSPQDPDPKPAQPEEVSARDFLQRLDLQIKLSTQAARKLKEESRDEESPYAASLYHS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.18 | 1.18145270901477 | 0.021 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)