Host taxon 10090
Protein NP_001157508.2
lymphocyte antigen 6E precursor
Mus musculus
Gene Ly6e, UniProt Q64253
>NP_001157508.2|Yersinia pseudotuberculosis IP 32953|lymphocyte antigen 6E precursor
MRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSAAGLGLRASIPLLGLGLLLSLLALLQLSP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.39 | 1.38513761888014 | 8.1e-15 | 28096329 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)