Host taxon 10090
Protein NP_034872.1
lymphocyte antigen 6D precursor
Mus musculus
Gene Ly6d, UniProt P35459
>NP_034872.1|Yersinia pseudotuberculosis IP 32953|lymphocyte antigen 6D precursor
MKTALLVLLVLAVATSPAWALRCHVCTNSANCKNPQVCPSNFYFCKTVTSVEPLNGNLVRKECANSCTSDYSQQGHVSSGSEVTQCCQTDLCNERLVSAAPGHALLSSVTLGLATSLSLLTVMALCL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.38 | 1.38038811269269 | 1.1e-6 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)