Host taxon 10090
Protein NP_001258345.1
lymphocyte antigen 6A-2/6E-1 precursor
Mus musculus
Gene Ly6a, UniProt P05533
>NP_001258345.1|Yersinia pseudotuberculosis IP 32953|lymphocyte antigen 6A-2/6E-1 precursor
MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAGVLLFSLSSVLLQTLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.55 | 2.54814841532957 | 1.1e-20 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)