Host taxon 10090
Protein NP_075892.3
LRP chaperone MESD isoform 1 precursor
Mus musculus
Gene Mesd, UniProt Q9ERE7
>NP_075892.3|Yersinia pseudotuberculosis IP 32953|LRP chaperone MESD isoform 1 precursor
MAASRWLRAVLLFLCASDLLLLPPPNAYAADTPGEATPPPRKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGGGSKEKNKTKPEKAKKKEGDPKPRASKEDNRAGSRREDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.59 | 0.585073622749796 | 0.024 | 28096329 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)