Host taxon 10090
Protein NP_653142.2
low affinity immunoglobulin gamma Fc region receptor IV precursor
Mus musculus
Gene Fcgr4, UniProt A0A0B4J1G0
>NP_653142.2|Yersinia pseudotuberculosis IP 32953|low affinity immunoglobulin gamma Fc region receptor IV precursor
MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKIQWSKEPQDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.82 | 1.81760434969463 | 1.7e-20 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)