Host taxon 10090
Protein NP_694709.1
liver-expressed antimicrobial peptide 2 precursor
Mus musculus
Gene Leap2, UniProt Q91V13
>NP_694709.1|Yersinia pseudotuberculosis IP 32953|liver-expressed antimicrobial peptide 2 precursor
MLQLKLFAVLLTCLLLLGQVNSSPVPEVSSAKRSRRMTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.55 | -2.55448891264823 | 2.6e-7 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)