Host taxon 10090
Protein NP_033068.1
lithostathine-1 precursor
Mus musculus
Gene Reg1, UniProt P43137
>NP_033068.1|Yersinia pseudotuberculosis IP 32953|lithostathine-1 precursor
MARNAYFILLSCLIVLSPSQGQEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.39 | -2.38778030209921 | 2.0e-13 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)