Host taxon 10090
Protein NP_001161239.1
lipid droplet-associated hydrolase isoform 2
Mus musculus
Gene Ldah, UniProt Q8BVA5
>NP_001161239.1|Yersinia pseudotuberculosis IP 32953|lipid droplet-associated hydrolase isoform 2
MASEVEEQIPVREEFFLCGGVETKIIKCGPWTNLFEKQDVSKPKQLIFIIPGNPGYSAFYVPFAKALYTLMKSRFPVWIISHAGFSVTPKDKKVLAAPQEESNAQKIEDVYGLNGQIEHKIAFLRAHVPKDVKLILIGHSVGTYMTLHVMKRVPELPVAHAFLLFPTIERMSESPNGKFATPFLCQFRYLLYATSYLLFKPCPEVIKSFIIQKLMGQMNIKLELPLTDILQPFCLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.49 | 0.491760730700356 | 0.031 | 28096329 | |
Retrieved 1 of 4 entries in 1.8 ms
(Link to these results)