Host taxon 10090
Protein NP_064428.1
linker for activation of T-cells family member 2 isoform a precursor
Mus musculus
Gene Lat2, UniProt Q9JHL0
>NP_064428.1|Yersinia pseudotuberculosis IP 32953|linker for activation of T-cells family member 2 isoform a precursor
MSAELELLWPVSGLLLLLLGATAWLCVHCSRPGVKRNEKIYEQRNRQENAQSSAAAQTYSLARQVWPGPQMDTAPNKSFERKNKMLFSHLEGPESPRYQNFYKGSNQEPDAAYVDPIPTNYYNWGCFQKPSEDDDSNSYENVLVCKPSTPESGVEDFEDYQNSVSIHQWRESKRTMGAPMSLSGSPDEEPDYVNGDVAAAENI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.75 | -0.74914244391537 | 0.0039 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)