Host taxon 10090
Protein NP_031677.1
leukocyte surface antigen CD53
Mus musculus
Gene Cd53, UniProt Q61451
>NP_031677.1|Yersinia pseudotuberculosis IP 32953|leukocyte surface antigen CD53
MGMSSLKLLKYVLFIFNLLFWVCGCCILGFGIYFLVQNTYGVLFRNLPFLTLGNILVIVGSIIMVVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSNFLYIGIITICVCVIQVLGMSFALTLNCQIDKTSQALGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.94 | 0.937341589171285 | 2.2e-6 | 28096329 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)