Host taxon 10090
Protein NP_082551.1
leucine-rich melanocyte differentiation-associated protein
Mus musculus
Gene Lrmda, UniProt Q9D9B4
>NP_082551.1|Yersinia pseudotuberculosis IP 32953|leucine-rich melanocyte differentiation-associated protein
MAGLMVSGTQVSYVGQSCREIPEHLGRDFGHFAKRLDLSFNLLRSLEGLSAFRSLEELILDNNLLGDDLVLPGLPHLHTLTLNKNQITDLEYLLDHLAEVTPSLEYLSLLGNVACPNELVNLEKDEEDYKRYRCFVLHKLPKLKFLDAQKVTRQEREEALVRGAFMKVVKPKASSEEEKAAAPENQPQYTPLPSGSRDLTSHRGVLGKGRYFYYGRNSEGNRFIRDDQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.28 | 1.27898755176651 | 0.0053 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)