Bacterial taxon 273123
Protein WP_002209017.1
large-conductance mechanosensitive channel protein MscL
Yersinia pseudotuberculosis IP 32953
Gene mscL, UniProt Q664V0
>WP_002209017.1|Yersinia pseudotuberculosis IP 32953|large-conductance mechanosensitive channel protein MscL
MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.86 | -2.85931871583198 | 0.00087 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.72 | -2.72134629037471 | 0.00029 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.96 | -1.96465112133655 | 0.041 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.74 | -1.74366456853231 | 0.047 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.5 ms
(Link to these results)