Host taxon 10090
Protein NP_081497.2
keratinocyte-associated protein 3
Mus musculus
Gene Krtcap3, UniProt Q8K177
>NP_081497.2|Yersinia pseudotuberculosis IP 32953|keratinocyte-associated protein 3
MRCCGVCAFDAARGPRRLMRVGLALILVGHVNLLVGAVLHGTVLRHVANPRGAVTPEYTTANVISVGSGLLSVSVGLVALLASRNLLRPRLHWALLTLALVNLLLSAACSMGLLLAVSLTVANGGRRLIADCHPGLMDPSIPLDQGPGHTDCSFDPTRIYDTALALWIPSLFMSAAEAALSGYCCVAALTLRGIGPCRKEGLQEQLQELTELELPECKRQENVQLLHGRQDFQALQKTWV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.09 | -1.08798782071951 | 0.0015 | 28096329 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)