Host taxon 10090
Protein NP_001307260.1
kallikrein-1 isoform 2 precursor
Mus musculus
Gene Klk1, UniProt P15947
>NP_001307260.1|Yersinia pseudotuberculosis IP 32953|kallikrein-1 isoform 2 precursor
MRFLILFLALSLGGIDAAPPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAEAH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.08 | -3.07934565577129 | 6.8e-24 | 28096329 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)