Host taxon 10090
Protein NP_064664.1
kallikrein 1-related peptidase b27 preproprotein
Mus musculus
Gene Klk1b27, UniProt Q9JM71
>NP_064664.1|Yersinia pseudotuberculosis IP 32953|kallikrein 1-related peptidase b27 preproprotein
MRFLILFLALSLGGIDAAPPVQSRIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWVLTAAHCYGNDTSQHNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPEDKSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPNENCAKAYVHKVTDVMLCVGETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVFTKLIKFTSWIKDTMAKNP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.82 | -2.8225392667313 | 0.00038 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)