Host taxon 10090
Protein NP_001191981.1
jun dimerization protein 2
Mus musculus
Gene Jdp2, UniProt P97875
>NP_001191981.1|Yersinia pseudotuberculosis IP 32953|jun dimerization protein 2
MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.43 | 1.42737759886443 | 4.4e-11 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)