Bacterial taxon 273123
Protein WP_002211845.1
iron/manganese ABC transporter permease subunit YfeD
Yersinia pseudotuberculosis IP 32953
Gene yfeD, UniProt Q669Y2
>WP_002211845.1|Yersinia pseudotuberculosis IP 32953|iron/manganese ABC transporter permease subunit YfeD
MNMLFSLISEPFAYPFMQRAIVAAIVTGVVCAILSCYLVLKGWSLMGDAISHAVLPGIVLAFWLGIPLVIGAFVSGIFCAVATGYLKENSRVKEDTVMGIVFSGMFAFGLVLFSRIDTDQHLSHILFGNMLGISLTELKQTLWIAGFTLLVVLLKRKDFMLYCFDPNHARVIGLPVKFLHYGLLCLLALTIVASLQAVGVILVIAMLIAPGIIAFMICRSFDQMLVVATLVSVVACVLGTLISFHIDGATGPCIVIIQALFFVVALIYNHIKPIKDRKMAPLTKAVNPENTAPSNLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.85 | 3.84929254151149 | 7.2e-18 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.72 | 3.72202865073179 | 6.3e-12 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.3 | 3.30339647754619 | 1.4e-17 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ 3.08 | 3.08089907566549 | 5.5e-10 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.9 ms
(Link to these results)