Host taxon 10090
Protein NP_034661.1
interleukin-18-binding protein precursor
Mus musculus
Gene Il18bp, UniProt Q9Z0M9
>NP_034661.1|Yersinia pseudotuberculosis IP 32953|interleukin-18-binding protein precursor
MTMRHCWTAGPSSWWVLLLYVHVILARATSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.21 | 1.21064855103902 | 6.2e-5 | 28096329 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)