Host taxon 10090
Protein NP_032376.1
interleukin-11 isoform 1 precursor
Mus musculus
Gene Il11, UniProt P47873
>NP_032376.1|Yersinia pseudotuberculosis IP 32953|interleukin-11 isoform 1 precursor
MNCVCRLVLVVLSLWPDRVVAPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.84 | 6.84028148162434 | 1.5e-22 | 28096329 | |
Retrieved 1 of 4 entries in 0.7 ms
(Link to these results)