Host taxon 10090
Protein NP_109619.1
interferon-induced transmembrane protein 2
Mus musculus
Gene Ifitm2, UniProt Q99J93
>NP_109619.1|Yersinia pseudotuberculosis IP 32953|interferon-induced transmembrane protein 2
MSHNSQAFLSTNAGLPPSYETIKEEYGVTELGEPSNSAVVRTTVINMPREVSVPDHVVWSLFNTLFFNACCLGFVAYAYSVKSRDRKMVGDVVGAQAYASTAKCLNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTPHSGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.63 | 1.62877753872562 | 1.8e-13 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)