Host taxon 10090
Protein NP_001028804.1
interferon induced transmembrane protein 6
Mus musculus
Gene Ifitm6, UniProt Q3SXF0
>NP_001028804.1|Yersinia pseudotuberculosis IP 32953|interferon induced transmembrane protein 6
MVKRDPDSAPVPSTVVCINSDVIQPDHITWSTFNTVFMNGCCLGFIAYIYSVKSRDRKMVGDMTGAQSHASTAKILNILALVISLIFYIMLIVLYSFNLLGNQR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 5.67 | 5.66901738594391 | 1.9e-29 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)