Host taxon 10090
Protein NP_001103968.1
interferon alpha/beta receptor 2 isoform b precursor
Mus musculus
Gene Ifnar2, UniProt O35664
>NP_001103968.1|Yersinia pseudotuberculosis IP 32953|interferon alpha/beta receptor 2 isoform b precursor
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGMARFLKFALLF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.95 | 0.951734816040552 | 5.7e-7 | 28096329 | |
Retrieved 1 of 3 entries in 1.5 ms
(Link to these results)