Host taxon 10090
Protein NP_081103.1
insulin-like growth factor-binding protein 3 receptor isoform 1 precursor
Mus musculus
Gene Tmem219, UniProt Q9D123
>NP_081103.1|Yersinia pseudotuberculosis IP 32953|insulin-like growth factor-binding protein 3 receptor isoform 1 precursor
MGSCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGGFLLTHTTGLRSPDIPQDWVSFLRSFGQLSLCPMNETVTGTWQGPHVVGLLTTLNFGDGPDRNKTQTFQAKIHGSQIGLTGSSAGESVLVTARVASGRTPGTCLYFSGVPKVLPSSQPPISCSEEGVGNATLSPVMGEECVRVWSHERLVLTELLTSEELALCGSRVLGLGFFLVLLCGLLCCTTAVCFHPRPEFHWSRTRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.82 | -0.817666841384265 | 0.026 | 28096329 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)